PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.016540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 153aa    MW: 17579.7 Da    PI: 10.476
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.016540.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.6e-18853147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+ +W+ +a++++ gR++k+c++rw++ 
   Cucsa.016540.1  8 RGHWRPAEDEKLRQLVQQHGPQNWNFVAEKLQ-GRSGKSCRLRWFNQ 53
                     899*****************************.***********996 PP

2Myb_DNA-binding60.63.2e-1960103146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l++a+  +G++ W++Iar ++ gRt++ +k++w+ 
   Cucsa.016540.1  60 RRPFTEEEEERLLEAHGIHGNK-WALIARLFP-GRTDNAVKNHWHV 103
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.716154IPR017930Myb domain
SuperFamilySSF466891.38E-306101IPR009057Homeodomain-like
SMARTSM007175.9E-14756IPR001005SANT/Myb domain
PfamPF002492.0E-17853IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-27961IPR009057Homeodomain-like
CDDcd001677.31E-131152No hitNo description
PROSITE profilePS5129428.13755109IPR017930Myb domain
SMARTSM007176.3E-1659107IPR001005SANT/Myb domain
PfamPF002492.7E-1660102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2262108IPR009057Homeodomain-like
CDDcd001677.40E-674102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
DDVKSCPRGH WRPAEDEKLR QLVQQHGPQN WNFVAEKLQG RSGKSCRLRW FNQLDPRINR  60
RPFTEEEEER LLEAHGIHGN KWALIARLFP GRTDNAVKNH WHVIMARKQR QQSNNNNLST  120
RKKITNITAA EDCSADSGSR NFETLTTGGI IT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-3331082107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818171e-131LN681817.1 Cucumis melo genomic scaffold, anchoredscaffold00015.
GenBankLN7132571e-131LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445798.17e-80PREDICTED: transcriptional activator Myb-like
SwissprotQ9FDW11e-39MYB44_ARATH; Transcription factor MYB44
TrEMBLV4TD412e-70V4TD41_9R
STRINGSolyc04g064540.2.18e-69(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.14e-61myb domain protein 54